Title: Search for peptidic molecular markers in hemolymph of crowd-(gregarious) and isolated-reared (solitary) desert locusts, Schistocerca gregaria
Authors: Rahman, MM
Vanden Bosch, Luc
Baggerman, Geert
Clynen, Elke
Hens, Korneel
Hoste, Bruno
Meylaers, Karen
Vercammen, Tom
Schoofs, Liliane
De Loof, Arnold
Breuer, Michael # ×
Issue Date: Nov-2002
Publisher: Elsevier
Series Title: Peptides vol:23 issue:11 pages:1907-1914
Abstract: An HPLC analysis of hemolymph extracts was undertaken to uncover differences between desert locusts, Schistocerca gregaria, reared under either crowded or isolated conditions. Some differences in the chromatographic pattern could be detected. One of the major peaks in the hemolymph of crowd-reared adults was found to be a minor one in isolated-reared individuals, whereas other peaks increased after solitarization. The differences became even more pronounced after several generations of isolated rearing. The dominant chromatographic peak in hemolymph extracts of the crowd-reared animals was identified as a novel peptide with a molecular mass of 6080 Da. Edman degradation in combination with enzymatic fragmentation and quadrupole-time of flight (Q-Tof) mass spectrometry revealed the full sequence: DNADEDTICVAADNKFYLYANSLKLYTCYNQLPKVYVVKPKSQCRSSLSDCPTS. This 54 aa-peptide is very abundant in hemolymph of crowd-reared adults. Its concentration in hemolymph amounts to 0.1 mM. To uncover the function, its effects were investigated in several bioassays, so far without positive results. One of the other peaks differentially expressed in the individuals of the two phases was identified as SGPI-2 (MW = 3794 Da), which is a serine protease inhibitor in locusts. (C) 2002 Elsevier Science Inc. All rights reserved.
ISSN: 0196-9781
Publication status: published
KU Leuven publication type: IT
Appears in Collections:Animal Physiology and Neurobiology Section - miscellaneous
Department of Biology - miscellaneous
Microbial and Molecular Systems - miscellaneous
× corresponding author
# (joint) last author

Files in This Item:
File Description Status SizeFormat
Rahman et al._2002_Peptides_vol23_p1907-1914.pdf Published 147KbAdobe PDFView/Open Request a copy

These files are only available to some KU Leuven Association staff members

All items in Lirias are protected by copyright, with all rights reserved.

© Web of science