Title: Isolation and identification of a cAMP generating peptide from the flesh fly, Neobellieria bullata (Diptera: Sarcophagidae)
Authors: Spittaels, K
Devreese, B
Schoofs, Liliane
Neven, H
Janssen, Ine
Grauwels, Luc
VanBeeumen, J
De Loof, Arnold # ×
Issue Date: 1996
Publisher: John Wiley & Sons
Series Title: Archives of Insect Biochemistry and Physiology vol:31 issue:2 pages:135-147
Abstract: The Manduca sexta Malpighian tubule assay system, developed to monitor adenylate cyclase activity, was used in combination with HPLC to isolate a novel cAMP generating peptide from 350,000 whole flesh flies, Neobellieria bullata. Mass spectrometry revealed a molecular mass of 5,047 daltons, and Edman degradation the following sequence: AGAEAEKLSGLSKYFNGTTMAGRANVAKATYAVIGIINVMKPKKK. This 48-mer peptide, called Neb-cGP, does not belong to the corticotropin releasing factor family of insect diuretic peptides. Electrophoresis and subsequent immunoblotting of peptides immunoprecipitated from a homogenate of entire flies showed that one fly contained approximately 0.003 to 0.03 mu g Neb-cGP and that 10 mu g represents the lowest immunostainable amount on a Western blot. (C) 1996 Wiley-Liss, Inc.
ISSN: 0739-4462
Publication status: published
KU Leuven publication type: IT
Appears in Collections:Animal Physiology and Neurobiology Section - miscellaneous
× corresponding author
# (joint) last author

Files in This Item:
File Description Status SizeFormat
Spittaels et al._1996_Arch Insect Biochem Physiol_vol31_p135-147.pdf Published 818KbAdobe PDFView/Open Request a copy

These files are only available to some KU Leuven Association staff members


All items in Lirias are protected by copyright, with all rights reserved.

© Web of science