Title: OD1, the first toxin isolated from the venom of the scorpion Odonthobuthus doriae active on voltage-gated Na+ channels
Authors: Jalali, Amir
Bosmans, Frank
Amininasab, Mehriar
Clynen, Elke
Cuypers, Eva
Zaremirakabadi, Abbas
Sarbolouki, Mohammad-Nabi
Schoofs, Liliane
Vatanpour, Hossein
Tytgat, Jan # ×
Issue Date: Aug-2005
Publisher: Elsevier on behalf of the Federation of European Biochemical Societies
Series Title: FEBS Letters vol:579 issue:19 pages:4181-4186
Abstract: In this study, we isolated and pharmacologically characterized the first alpha-like toxin from the venom of the scarcely studied Iranian scorpion Odonthobuthus doriae. The toxin was termed OD1 and its primary sequence was determined: GVRDAYIADDKNCVYTCASNGYCNTECTKNGAESGYCQWIGRYGNACWCIKLPDEVPIRIPGKCR. Using the two-electrode voltage clamp technique, the pharmacological effects of OD1 were studied on three cloned voltage-gated Na+ channels expressed in Xenopus laevis oocytes (Na(v)1.2/beta1, Na(v)1.5/beta1, para/tipE). The inactivation process of the insect channel, para/tipE, was severely hampered by 200 nM of OD1 (EC50 = 80+/-14 nM) while Na(v)1.2/beta1 still was not affected at concentrations up to 5 microM. Na(v)1.5/beta1 was influenced at micromolar concentrations.
ISSN: 0014-5793
Publication status: published
KU Leuven publication type: IT
Appears in Collections:Toxicology and Pharmacology
Animal Physiology and Neurobiology Section - miscellaneous
× corresponding author
# (joint) last author

Files in This Item:
File Description Status SizeFormat
Jalali et al._2005_FEBS Letters_vol579_p4181-4186.pdf Published 240KbAdobe PDFView/Open Request a copy

These files are only available to some KU Leuven Association staff members

All items in Lirias are protected by copyright, with all rights reserved.

© Web of science